PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC07G12320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 266aa    MW: 27828.8 Da    PI: 4.5557
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC07G12320.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.81.8e-23177221145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      ++epgrCrRtDGKkWRC+r++++++k+CErH+hrgr+r  + ++e
  OPUNC07G12320.1 177 EPEPGRCRRTDGKKWRCWRNAIANEKYCERHMHRGRKRPVQLVVE 221
                      69************************************9998875 PP

2QLQ54.34.1e-19111146237
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      aFTa+Qlq+L++Q  +y+y+aa++PvP +L+++i+k
  OPUNC07G12320.1 111 AFTAMQLQELEQQSRVYQYMAARVPVPTHLVFPIWK 146
                      8*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.7E-8110146IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.3E-12111145IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.922111146IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.302177221IPR014977WRC domain
PfamPF088791.3E-19178216IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MAAEGEAKKD NARNPPGGDG GGGGGEEEED NSLAVGEAAV GEGEAGEGGG GEKAADREGK  60
EDVEEGGVCK DLVLVDDAVP VEDPEEAAAT AALQEEMKAL VASVPVGAGA AFTAMQLQEL  120
EQQSRVYQYM AARVPVPTHL VFPIWKSVTG ASSEGAQKYP TLMGLATLCL DFGKNPEPEP  180
GRCRRTDGKK WRCWRNAIAN EKYCERHMHR GRKRPVQLVV EDDEPDSTSG SKSASGKATE  240
GGKKTDDKSS SSKKLAVAAP AAVEST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0664000.0AK066400.1 Oryza sativa Japonica Group cDNA clone:J013062O07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644678.11e-150PREDICTED: growth-regulating factor 11
SwissprotQ6AWX81e-152GRF11_ORYSJ; Growth-regulating factor 11
TrEMBLA0A0E0LKD20.0A0A0E0LKD2_ORYPU; Uncharacterized protein
STRINGBGIOSGA025662-PA1e-150(Oryza sativa Indica Group)
STRINGLOC_Os07g28430.11e-150(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67353152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-29growth-regulating factor 5